PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000125782
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 436aa    MW: 47333.8 Da    PI: 6.4449
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000125782genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.99.9e-34243299259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    dDgynWrKYGqK+vkgsefprsYY+Ct+++Cpvkkkvers  +++++ei+Y+geHnhe
  MDP0000125782 243 DDGYNWRKYGQKQVKGSEFPRSYYKCTHPNCPVKKKVERSI-EGQITEIIYRGEHNHE 299
                    8****************************************.***************8 PP

2WRKY34.73.6e-11415436122
                    ---SS-EEEEEEE--TT-SS-E CS
           WRKY   1 ldDgynWrKYGqKevkgsefpr 22 
                    ldDgy+WrKYGqK+vkg+++pr
  MDP0000125782 415 LDDGYRWRKYGQKVVKGNPYPR 436
                    59*******************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.1E-29230300IPR003657WRKY domain
PROSITE profilePS5081122.297237301IPR003657WRKY domain
SuperFamilySSF1182901.03E-25240300IPR003657WRKY domain
SMARTSM007743.2E-36242300IPR003657WRKY domain
PfamPF031062.3E-26243299IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.9E-13400436IPR003657WRKY domain
SuperFamilySSF1182901.7E-9407436IPR003657WRKY domain
PROSITE profilePS5081116.421410436IPR003657WRKY domain
PfamPF031066.0E-7416436IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MADNQEQPPT PPSGPSQPSK PAATHHPPRP TITLPQRTSF ESIFSSAGGG NTGPGLGLGF  60
SPGPMTLVSN FFSDGGDDCK SFSQLLAGAM TSPSPRALGF PQLEERNSGD GDGSSDFRFK  120
QNRPPPMFSV PTPSGFLDSP GIFSPGQGPF GMTHQQALAQ VTAQAAALSP SFFNFSTEHS  180
TSFSTAPATV LTQPPSFTSD TTPPQEIPSG TPDFAVATKE SSDISLSDQR SQLSSFTVDK  240
PNDDGYNWRK YGQKQVKGSE FPRSYYKCTH PNCPVKKKVE RSIEGQITEI IYRGEHNHER  300
HQSKRPLNGN SQANSDLASQ VHGGNLNKPK EGTGPYSMSK KRQESSQATH DNLSGTSDSE  360
EVEDAETRVD EKDEDQPDPK RRNTEVRSEA AAASTHRTVT EPRIIVQTTS EVDLLDDGYR  420
WRKYGQKVVK GNPYPR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A1e-162432991572WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008360108.10.0PREDICTED: probable WRKY transcription factor 3
SwissprotQ9XI901e-126WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLM5XF340.0M5XF34_PRUPE; Uncharacterized protein
STRINGVIT_01s0011g00220.t011e-151(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF154534100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-110WRKY DNA-binding protein 4